|
US$57
Valuation
72/100
SEO score
September, 10 2025
|
| Title | Beanie Bags Häkeltaschen |
| Description | Was zeichnet mich aus? |
| Keyword |
| Keywords | Freq | Title | Desc | <H> | Recommendation |
|---|---|---|---|---|---|
| mich | 4 | ✘ | ✔ | ✔ | 'mich' missing in the title tag. |
| lesen | 2 | ✘ | ✘ | ✘ | Use 'lesen' in all sections. |
| über | 2 | ✘ | ✘ | ✘ | No presence of 'über' detected. |
| meine | 2 | ✘ | ✘ | ✔ | 'meine' should appear above content. |
| arbeit | 2 | ✘ | ✘ | ✘ | Place 'arbeit' in all SEO fields. |
| mehr | 2 | ✘ | ✘ | ✔ | 'mehr' should appear above content. |
| leidenschaft | 2 | ✘ | ✘ | ✔ | Add 'leidenschaft' to meta and title. |
| alle | 2 | ✘ | ✘ | ✘ | No presence of 'alle' detected. |
| lerne | 1 | ✘ | ✘ | ✘ | 'lerne' not found, use it broadly. |
| ricacôted’ivoirecuraçaodänemarkdeutschlanddominicadominikanischerepublikdschibutiecuadorelsalvadoreritreaestlandfalk--ndinselnfäröerfidschifinnlandfrankreichfranzösisch-guayanafranzösisch-polynesiengabungambiageorgienghanagibraltargrenadagriechenlandgrönlandguadeloupeguamguatemalaguernseyguineaguinea-bissauguyanahaitihondurasindienindonesienirakiranirlandislandisleofmanisraelitalienjamaikajapanjemenjerseyjordanienkaimaninselnkambodschakamerunkanadakasachstankatarkeniakirgisistankiribatikokosinselnkolumbienkomorenkongo-brazzavillekongo-kinshasakosovokroatienkubakuwaitlaoslesotholettlandlibanonliberialibyenliechtensteinlitauenluxemburgmadagaskarmalawimalaysiamaledivenmalimaltamarokkomarshallinselnmartiniquemauretanienmauritiusmayottemexikomikronesienmonacomongoleimontenegromontserratmosambikmyanmarnamibianaurunepalneukaledonienneuseelandnicaraguaniederlandenigernigerianiuenordkoreanördlichema---nennordmazedoniennorfolkinselnorwegenomanÖsterreichpakistanpalästinensischeautonomiegebietepalaupanamapapua-neuguineaparaguayperuphilippinenpolenportugalpuertoricorepublikmoldauréunionruandarumänienrusslandsalomonensambiasamoasanmarinosão | 1 | ✘ | ✘ | ✘ | Consider using 'ricacôted’ivoirecuraçaodänemarkdeutschlanddominicadominikanischerepublikdschibutiecuadorelsalvadoreritreaestlandfalk--ndinselnfäröerfidschifinnlandfrankreichfranzösisch-guayanafranzösisch-polynesiengabungambiageorgienghanagibraltargrenadagriechenlandgrönlandguadeloupeguamguatemalaguernseyguineaguinea-bissauguyanahaitihondurasindienindonesienirakiranirlandislandisleofmanisraelitalienjamaikajapanjemenjerseyjordanienkaimaninselnkambodschakamerunkanadakasachstankatarkeniakirgisistankiribatikokosinselnkolumbienkomorenkongo-brazzavillekongo-kinshasakosovokroatienkubakuwaitlaoslesotholettlandlibanonliberialibyenliechtensteinlitauenluxemburgmadagaskarmalawimalaysiamaledivenmalimaltamarokkomarshallinselnmartiniquemauretanienmauritiusmayottemexikomikronesienmonacomongoleimontenegromontserratmosambikmyanmarnamibianaurunepalneukaledonienneuseelandnicaraguaniederlandenigernigerianiuenordkoreanördlichema---nennordmazedoniennorfolkinselnorwegenomanÖsterreichpakistanpalästinensischeautonomiegebietepalaupanamapapua-neuguineaparaguayperuphilippinenpolenportugalpuertoricorepublikmoldauréunionruandarumänienrusslandsalomonensambiasamoasanmarinosão' in every tag. |
| verdechilechinacookinselncosta | 1 | ✘ | ✘ | ✘ | Place 'verdechilechinacookinselncosta' in all SEO fields. |
| darussalambulgarienburkinafasoburundicabo | 1 | ✘ | ✘ | ✘ | Place 'darussalambulgarienburkinafasoburundicabo' in all SEO fields. |
| immerbesser | 1 | ✘ | ✘ | ✘ | No presence of 'immerbesser' detected. |
| ozeanbrunei | 1 | ✘ | ✘ | ✘ | No presence of 'ozeanbrunei' detected. |
| indischen | 1 | ✘ | ✘ | ✘ | 'indischen' not found, use it broadly. |
| Host | Type | Ttl | Other |
|---|---|---|---|
| beaniethebag.com | A | 86396 | ip:162.159.129.70 |
| beaniethebag.com | A | 86396 | ip:162.159.128.70 |
| beaniethebag.com | NS | 86400 | target:ns14.jimdo.com |
| beaniethebag.com | NS | 86400 | target:ns13.jimdo.com |
| beaniethebag.com | SOA | 3600 | mname:dns1.p01.nsone.netrname:hostmaster.jimdo.comserial:1756145613refresh:43200retry:7200expire:1209600minimum-ttl:3600 |
| beaniethebag.com.localhost | AAAA | 86400 | ipv6:::1 |
|
HTTP/1.1 301 Moved Permanently Date: Wed, 10 Sep 2025 02:02:03 GMT Content-Type: text/html Content-Length: 167 Connection: keep-alive Cache-Control: max-age=3600 Expires: Wed, 10 Sep 2025 03:02:03 GMT Location: https://beaniethebag.com/ Server: cloudflare CF-RAY: 97cb5749de0c07d9-IAD alt-svc: h3=":443"; ma=86400 HTTP/2 301 date: Wed, 10 Sep 2025 02:02:03 GMT content-type: text/html content-length: 167 location: https://www.beaniethebag.com/ cache-control: max-age=3600 expires: Wed, 10 Sep 2025 03:02:03 GMT server: cloudflare cf-ray: 97cb574acced058b-IAD alt-svc: h3=":443"; ma=86400 HTTP/2 403 date: Wed, 10 Sep 2025 02:02:03 GMT content-type: text/html; charset=UTF-8 x-frame-options: SAMEORIGIN referrer-policy: same-origin cache-control: private, max-age=0, no-store, no-cache, must-revalidate, post-check=0, pre-check=0 expires: Thu, 01 Jan 1970 00:00:01 GMT set-cookie: __cf_bm=mPuYXyVPuk.SVqX9mnkHeaNzjjTFvH_jhkU337fUbXg-1757469723-1.0.1.1-W8q6c67oDoYCeZuM7kKe8Czb7pSLQaT3IArbOlCoXEairFEMSSRvjMF4N5Uc4I__YITEbGKnUQw01TkqMqLK00cVyFd1TAZuDugeC6YEgII; path=/; expires=Wed, 10-Sep-25 02:32:03 GMT; domain=.www.beaniethebag.com; HttpOnly; Secure; SameSite=None server: cloudflare cf-ray: 97cb574b2f55d6b5-IAD alt-svc: h3=":443"; ma=86400 |
|
Domain Name: beaniethebag.com Registry Domain ID: 3013475486_DOMAIN_COM-VRSN Registrar WHOIS Server: whois.registrar.internetx.com Registrar URL: https://registrar.internetx.com Updated Date: 2025-08-25T18:13:06Z Creation Date: 2025-08-25T18:13:00Z Registrar Registration Expiration Date: 2026-08-25T18:13:01Z Registrar: InterNetX GmbH Registrar IANA ID: 151 Registrar Abuse Contact Email: domain-abuse@internetx.com Registrar Abuse Contact Phone: +49.94159559482 Domain Status: clientTransferProhibited https://www.icann.org/epp#clientTransferProhibited Registrant Organization: beaniethebag Registrant State/Province: AT Registrant Country: AT Registrant Email: https://whoispro.domain-robot.org/whois/beaniethebag.com Admin Email: https://whoispro.domain-robot.org/whois/beaniethebag.com Tech Email: https://whoispro.domain-robot.org/whois/beaniethebag.com Name Server: ns13.jimdo.com Name Server: ns14.jimdo.com DNSSEC: unsigned URL of the ICANN WHOIS Data Problem Reporting System: https://wdprs.internic.net/ >>> Last update of WHOIS database: 2025-09-10T02:02:05Z <<< |
| Website Ranking | 8300888 |
| Website Valuation (USD) | $57 |
| Daily ads revenue (USD) | $0.11 |
| Daily Visitors | 14 |
| Weekly Visitors | 98 |
| Monthly Visitors | 420 |
| Desktop | 79/100 | ✔ |
| Mobile | 50/100 | ❗ |
| Server IP | 162.159.129.70 |
| Server Location | Not Available |
| Service Provider | CLOUDFLARENET |
| Age | 0 Years, 16 Days |
| Created | 25th-Aug-2025 |
| Updated | 25th-Aug-2025 |
| Expiry | 25th-Aug-2026 |
| Field | Data | Result |
|---|---|---|
| Page Size | 7 KB | ✔ |
| Compression | 5 KB (-33.1%) | ✔ |
| Text/Html Ratio | 3435 / 94301 (bytes) = 3.64% | ❗ |
| Load Time | 0.18 second | ✔ |
| Mobile Ready | 0/100 | ✘ |
| In-Page Links | 9 | ✔ |
| Doc Type | HTML 5 | ✔ |
| Encoding | UTF-8 | ✔ |
| Declared Language | EN-US | ✔ |
| Preferred Domain | Yes | ✔ |
| Robots.txt | Yes | ✔ |
| Url Rewrite | No | ✔ |
| Underscores in url | No | ✔ |
| Images Without ALT | 0 / 1 | ✔ |
| Embedded Objects (Desktop) | No | ✔ |
| Embedded Objects (Mobile) | No | ✔ |
| Iframe | No | ✔ |
| Custom 404 page | Yes | ✔ |
| Email Privacy | Yes | ✔ |
| Gsafe browsing | Yes | ✔ |
| Analytics | No | ✘ |
| W3C Validity | No | ✘ |
| Briidmagazine.com |
| Sputterist.com |
| Vayudeck.com |
| Athynaglobal.com |
| Homeownerfix.com |
| Hallowfinds.com |
| Alaryia.com |
| Raldeaudio.com |
| Hellosparkmail.com |
| Kostabak.com |